PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g079980.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family BES1
Protein Properties Length: 328aa    MW: 34977.2 Da    PI: 8.8938
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g079980.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222182.1e-67281591133
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         g+++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++p+  +e++g+sa+++p+
  Sopim04g079980.0.1  28 GSGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVEPDGTTYRKGCRPT-PMEIGGTSANITPS 117
                         6899************************************************************************.************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasa 133
                         ss + s+ ss++asp++sy+ sp+sssfpsps+ d ++++++
  Sopim04g079980.0.1 118 SSRNPSPPSSYFASPIPSYQVSPTSSSFPSPSRGDANMSSHP 159
                         ***********************************9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.2E-6229155IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MWEGGGLPVE GGGGVGEGGG VGGGGGGGSG RRKPSWRERE NNRRRERRRR AIAAKIYSGL  60
RAQGNYNLPK HCDNNEVLKA LCVEAGWIVE PDGTTYRKGC RPTPMEIGGT SANITPSSSR  120
NPSPPSSYFA SPIPSYQVSP TSSSFPSPSR GDANMSSHPF AFLHSSIPLS LPPLRISNSA  180
PVTPPLSSPT RVPKQIFNLE TLARESMSAL NIPFFAASAP TSPTRGQRFT PATIPECDES  240
DSSTIDSGQW MSFQKYAANG IPTSPTFNLI KPVAQRIPSN DMIIDKGKSI EFDFENVSVK  300
AAWEGEKIHE VGLDDLELTL GSGTARM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13049RRKPSWRERENNRRRERRRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238228.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3071e-118BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV770.0K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-103BES1 family protein